p19 INK4d (CDKN2D) (NM_079421) Human Mass Spec Standard
CAT#: PH301155
CDKN2D MS Standard C13 and N15-labeled recombinant protein (NP_524145)
View other "p19 INK4d" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CDKN2D MS Standard C13 and N15-labeled recombinant protein (NP_524145) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201155 |
Predicted MW | 17.7 kDa |
Protein Sequence |
>RC201155 protein sequence
Red=Cloning site Green=Tags(s) MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQ DTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGL TPLELALQRGAQDLVDILQGHMVAPL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_524145 |
RefSeq Size | 1162 |
RefSeq ORF | 498 |
Synonyms | INK4D; p19; p19-INK4D |
Locus ID | 1032 |
Cytogenetics | 19p13.2 |
Summary | The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400682 | CDKN2D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409201 | CDKN2D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400682 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 1 |
CNY 3,080.00 |
|
LY409201 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2 |
CNY 3,080.00 |
|
PH314065 | CDKN2D MS Standard C13 and N15-labeled recombinant protein (NP_001791) |
CNY 19,520.00 |
|
TP301155 | Recombinant protein of human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP314065 | Recombinant protein of human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它p19 INK4d产品