p19 INK4d (CDKN2D) (NM_079421) Human Tagged ORF Clone
CAT#: RC201155
CDKN2D (Myc-DDK-tagged)-Human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2
ORF Plasmid: tGFP
"NM_079421" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 5,130.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | INK4D; p19; p19-INK4D |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC201155 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCTGCTGGAGGAGGTTCGCGCCGGCGACCGGCTGAGTGGGGCGGCGGCCCGGGGCGACGTGCAGGAGG TGCGCCGCCTTCTGCACCGCGAGCTGGTGCATCCCGACGCCCTCAACCGCTTCGGCAAGACGGCGCTGCA GGTCATGATGTTTGGCAGCACCGCCATCGCCCTGGAGCTGCTGAAGCAAGGTGCCAGCCCCAATGTCCAG GACACCTCCGGTACCAGTCCAGTCCATGACGCAGCCCGCACTGGATTCCTGGACACCCTGAAGGTCCTAG TGGAGCACGGGGCTGATGTCAACGTGCCTGATGGCACCGGGGCACTTCCAATCCATCTGGCAGTTCAAGA GGGTCACACTGCTGTGGTCAGCTTTCTGGCAGCTGAATCTGATCTCCATCGCAGGGACGCCAGGGGTCTC ACACCCTTGGAGCTGGCACTGCAGAGAGGGGCTCAGGACCTCGTGGACATCCTGCAGGGCCACATGGTGG CCCCGCTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC201155 protein sequence
Red=Cloning site Green=Tags(s) MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQ DTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGL TPLELALQRGAQDLVDILQGHMVAPL myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_079421 |
ORF Size | 498 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_079421.2, NP_524145.1 |
RefSeq Size | 1162 bp |
RefSeq ORF | 501 bp |
Locus ID | 1032 |
UniProt ID | P55273 |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle |
MW | 17.7 kDa |
Gene Summary | The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC201155L1 | Lenti ORF clone of Human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2, Myc-DDK-tagged |
CNY 4,200.00 |
|
RC201155L2 | Lenti ORF clone of Human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2, mGFP tagged |
CNY 6,840.00 |
|
RC201155L3 | Lenti ORF clone of Human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2, Myc-DDK-tagged |
CNY 6,840.00 |
|
RC201155L4 | Lenti ORF clone of Human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2, mGFP tagged |
CNY 6,840.00 |
|
RG201155 | CDKN2D (tGFP-tagged) - Human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2 |
CNY 5,420.00 |
|
SC120263 | CDKN2D (untagged)-Human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2 |
CNY 3,600.00 |
其它p19 INK4d产品