14-3-3 beta (YWHAB) (NM_139323) Human Mass Spec Standard
CAT#: PH300402
YWHAB MS Standard C13 and N15-labeled recombinant protein (NP_647539)
View other "14-3-3 beta" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | YWHAB MS Standard C13 and N15-labeled recombinant protein (NP_647539) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200402 |
Predicted MW | 28.1 kDa |
Protein Sequence |
>RC200402 protein sequence
Red=Cloning site Green=Tags(s) MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQK TERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNK QTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNE ESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_647539 |
RefSeq Size | 3136 |
RefSeq ORF | 738 |
Synonyms | GW128; HEL-S-1; HS1; KCIP-1; YWHAA |
Locus ID | 7529 |
Cytogenetics | 20q13.12 |
Summary | This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403387 | YWHAB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418677 | YWHAB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403387 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide (YWHAB), transcript variant 2 |
CNY 3,080.00 |
|
LY418677 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide (YWHAB), transcript variant 1 |
CNY 3,080.00 |
|
PH315940 | YWHAB MS Standard C13 and N15-labeled recombinant protein (NP_003395) |
CNY 19,520.00 |
|
TP300402 | Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide (YWHAB), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP315940 | Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide (YWHAB), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它14-3-3 beta产品