MTFR1L (NM_019557) Human Mass Spec Standard
CAT#: PH300212
FAM54B MS Standard C13 and N15-labeled recombinant protein (NP_062457)
View other "MTFR1L" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | FAM54B MS Standard C13 and N15-labeled recombinant protein (NP_062457) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200212 |
Predicted MW | 32 kDa |
Protein Sequence |
>RC200212 protein sequence
Red=Cloning site Green=Tags(s) MSGMEATVTIPIWQNKPHGAARSVVRRIGTNLPLKPCARASFETLPNISDLCLRDVPPVPTLADIAWIAA DEEETYARVRSDTRPLRHTWKPSPLIVMQRNASVPNLRGSEERLLALKKPALPALSRTTELQDELSHLRS QIAKIVAADAASASLTPDFLSPGSSNVSSPLPCFGSSFHSTTSFVISDITEETEVEVPELPSVPLLCSAS PECCKPEHKAACSSSEEDDCVSLSKASSFADMMGILKDFHRMKQSQDLNRSLLKEEDPAVLISEVLRRKF ALKEEDISRKGN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_062457 |
RefSeq Size | 2120 |
RefSeq ORF | 876 |
Synonyms | FAM54B; HYST1888; MST116; MSTP116 |
Locus ID | 56181 |
Cytogenetics | 1p36.11 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412698 | MTFR1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420464 | MTFR1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420465 | MTFR1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420466 | MTFR1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412698 | Transient overexpression lysate of family with sequence similarity 54, member B (FAM54B), transcript variant 1 |
CNY 3,080.00 |
|
LY420464 | Transient overexpression lysate of family with sequence similarity 54, member B (FAM54B), transcript variant 2 |
CNY 3,080.00 |
|
LY420465 | Transient overexpression lysate of family with sequence similarity 54, member B (FAM54B), transcript variant 3 |
CNY 3,080.00 |
|
LY420466 | Transient overexpression lysate of family with sequence similarity 54, member B (FAM54B), transcript variant 4 |
CNY 3,080.00 |
|
TP300212 | Recombinant protein of human family with sequence similarity 54, member B (FAM54B), transcript variant 1, 20 µg |
CNY 2,900.00 |