United States
Germany
Japan
United Kingdom
China
MTFR1L (NM_019557) Human Recombinant Protein
CAT＃: TP300212
Recombinant protein of human family with sequence similarity 54, member B (FAM54B), transcript variant 1, 20 µg
View other "MTFR1L" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200212 protein sequence
Red=Cloning site Green=Tags(s) MSGMEATVTIPIWQNKPHGAARSVVRRIGTNLPLKPCARASFETLPNISDLCLRDVPPVPTLADIAWIAA DEEETYARVRSDTRPLRHTWKPSPLIVMQRNASVPNLRGSEERLLALKKPALPALSRTTELQDELSHLRS QIAKIVAADAASASLTPDFLSPGSSNVSSPLPCFGSSFHSTTSFVISDITEETEVEVPELPSVPLLCSAS PECCKPEHKAACSSSEEDDCVSLSKASSFADMMGILKDFHRMKQSQDLNRSLLKEEDPAVLISEVLRRKF ALKEEDISRKGN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_062457 |
| Locus ID | 56181 |
| UniProt ID | Q9H019 |
| Refseq Size | 2120 |
| Cytogenetics | 1p36.11 |
| Refseq ORF | 876 |
| Synonyms | FAM54B; HYST1888; MST116; MSTP116 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412698 | MTFR1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420464 | MTFR1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420465 | MTFR1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420466 | MTFR1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412698 | Transient overexpression lysate of family with sequence similarity 54, member B (FAM54B), transcript variant 1 |
CNY 3,080.00 |
|
| LY420464 | Transient overexpression lysate of family with sequence similarity 54, member B (FAM54B), transcript variant 2 |
CNY 3,080.00 |
|
| LY420465 | Transient overexpression lysate of family with sequence similarity 54, member B (FAM54B), transcript variant 3 |
CNY 3,080.00 |
|
| LY420466 | Transient overexpression lysate of family with sequence similarity 54, member B (FAM54B), transcript variant 4 |
CNY 3,080.00 |
|
| PH300212 | FAM54B MS Standard C13 and N15-labeled recombinant protein (NP_062457) |
CNY 19,520.00 |
