C6ORF173 (CENPW) (NM_001012507) Human Tagged ORF Clone
CAT#: RC220318
CENPW (Myc-DDK-tagged)-Human centromere protein W (CENPW)
ORF Plasmid: tGFP
"NM_001012507" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | C6orf173; CENP-W; CUG2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC220318 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGCTGTCGACCATAGTCTCCCAGAGGAAGCAGATAAAGCGGAAGGCTCCCCGTGGCTTTCTAAAGC GAGTCTTCAAGCGAAAGAAGCCTCAACTTCGTCTGGAGAAAAGTGGTGACTTATTGGTCCATCTGAACTG TTTACTGTTTGTTCATCGATTAGCAGAAGAGTCCAGGACAAACGCTTGTGCGAGTAAATGTAGAGTCATT AACAAGGAGCATGTACTGGCCGCAGCAAAGGTAATTCTAAAGAAGAGCAGAGGT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC220318 protein sequence
Red=Cloning site Green=Tags(s) MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRTNACASKCRVI NKEHVLAAAKVILKKSRG TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001012507 |
ORF Size | 264 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_001012507.4 |
RefSeq Size | 1135 bp |
RefSeq ORF | 267 bp |
Locus ID | 387103 |
UniProt ID | Q5EE01 |
MW | 10.1 kDa |
Gene Summary | Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation (By similarity). The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres (By similarity). Part of a nucleosome-associated complex that binds specifically to histone H3-containing nucleosomes at the centromere, as opposed to nucleosomes containing CENPA. Component of the heterotetrameric CENP-T-W-S-X complex that binds and supercoils DNA, and plays an important role in kinetochore assembly. CENPW has a fundamental role in kinetochore assembly and function. It is one of the inner kinetochore proteins, with most further proteins binding downstream. Required for normal chromosome organization and normal progress through mitosis.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC220318L1 | Lenti ORF clone of Human centromere protein W (CENPW), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC220318L2 | Lenti ORF clone of Human centromere protein W (CENPW), mGFP tagged |
CNY 5,890.00 |
|
RC220318L3 | Lenti ORF clone of Human centromere protein W (CENPW), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC220318L4 | Lenti ORF clone of Human centromere protein W (CENPW), mGFP tagged |
CNY 5,890.00 |
|
RG220318 | CENPW (tGFP-tagged) - Human centromere protein W (CENPW) |
CNY 2,800.00 |
|
SC301670 | CENPW (untagged)-Human centromere protein W (CENPW) |
CNY 1,200.00 |
其它C6ORF173产品