United States
Germany
Japan
United Kingdom
China
ORAI1 (NM_032790) Human Tagged ORF Clone
CAT＃: RC210034
ORAI1 (Myc-DDK-tagged)-Human ORAI calcium release-activated calcium modulator 1 (ORAI1)
ORF Plasmid: tGFP
"NM_032790" in other vectors (7)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
| Cited in 7 publications. |
Product images
CNY 300.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | CRACM1; IMD9; ORAT1; TAM2; TMEM142A |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC210034 representing NM_032790
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCATCCGGAGCCCGCCCCGCCCCCGAGCCGCAGCAGTCCCGAGCTTCCCCCAAGCGGCGGCAGCACCA CCAGCGGCAGCCGCCGGAGCCGCCGCCGCAGCGGGGACGGGGAGCCCCCGGGGGCCCCGCCACCGCCGCC GTCCGCCGTCACCTACCCGGACTGGATCGGCCAGAGTTACTCCGAGGTGATGAGCCTCAACGAGCACTCC ATGCAGGCGCTGTCCTGGCGCAAGCTCTACTTGAGCCGCGCCAAGCTTAAAGCCTCCAGCCGGACCTCGG CTCTGCTCTCCGGCTTCGCCATGGTGGCAATGGTGGAGGTGCAGCTGGACGCTGACCACGACTACCCACC GGGGCTGCTCATCGCCTTCAGTGCCTGCACCACAGTGCTGGTGGCTGTGCACCTGTTTGCGCTCATGATC AGCACCTGCATCCTGCCCAACATCGAGGCGGTGAGCAACGTGCACAATCTCAACTCGGTCAAGGAGTCCC CCCATGAGCGCATGCACCGCCACATCGAGCTGGCCTGGGCCTTCTCCACCGTCATCGGCACGCTGCTCTT CCTAGCTGAGGTGGTGCTGCTCTGCTGGGTCAAGTTCTTGCCCCTCAAGAAGCAGCCAGGCCAGCCAAGG CCCACCAGCAAGCCCCCCGCCAGTGGCGCAGCAGCCAACGTCAGCACCAGCGGCATCACCCCGGGCCAGG CAGCTGCCATCGCCTCGACCACCATCATGGTGCCCTTCGGCCTGATCTTTATCGTCTTCGCCGTCCACTT CTACCGCTCACTGGTTAGCCATAAGACCGACCGACAGTTCCAGGAGCTCAACGAGCTGGCGGAGTTTGCC CGCTTACAGGACCAGCTGGACCACAGAGGGGACCACCCCCTGACGCCCGGCAGCCACTATGCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC210034 representing NM_032790
Red=Cloning site Green=Tags(s) MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSYSEVMSLNEHS MQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLLIAFSACTTVLVAVHLFALMI STCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPLKKQPGQPR PTSKPPASGAAANVSTSGITPGQAAAIASTTIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFA RLQDQLDHRGDHPLTPGSHYA myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_032790 |
| ORF Size | 903 bp |
| OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_032790.3 |
| RefSeq Size | 1497 bp |
| RefSeq ORF | 906 bp |
| Locus ID | 84876 |
| UniProt ID | Q96D31 |
| Protein Families | Transmembrane |
| MW | 32.5 kDa |
| Gene Summary | The protein encoded by this gene is a membrane calcium channel subunit that is activated by the calcium sensor STIM1 when calcium stores are depleted. This type of channel is the primary way for calcium influx into T-cells. Defects in this gene are a cause of immune dysfunction with T-cell inactivation due to calcium entry defect type 1 (IDTICED1). [provided by RefSeq, Sep 2011] |
Citations (7)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
Inhibitory effects of α-Mangostin on T cell cytokine secretion via ORAI1 calcium channel and K+ channels inhibition
,Kim, HJ;Park, S;Shin, HY;Nam, YR;Lam Hong, PT;Chin, YW;Nam, JH;Kim, WK;,
PeerJ
,PubMed ID 33717700
[ORAI1]
|
|
Nootkatol prevents ultraviolet radiation-induced photoaging via ORAI1 and TRPV1 inhibition in melanocytes and keratinocytes
,Woo, JH;Nam, DY;Kim, HJ;Hong, PTL;Kim, WK;Nam, JH;,
The Korean journal of physiology & pharmacology : official journal of the Korean Physiological Society and the Korean Society of Pharmacology
,PubMed ID 33361541
[ORAI1]
|
|
Spirodela polyrhiza extract modulates the activation of atopic dermatitis-related ion channels, Orai1 and TRPV3, and inhibits mast cell degranulation
,Nam, JH;Jung, HW;Chin, YW;Yang, WM;Bae, HS;Kim, WK;,
Pharm Biol
,PubMed ID 28290212
[ORAI1]
|
|
Modulatory effects of the fruits of Tribulus terrestris L. on the function of atopic dermatitis-related calcium channels, Orai1 and TRPV3
,Nam, JH;Jung, HW;Chin, Y;Kim, WK;Bae, HS;,
Asian Pacific Journal of Tropical Biomedicine
[ORAI1]
|
|
Valencene from the Rhizomes of Cyperus rotundus Inhibits Skin Photoaging-Related Ion Channels and UV-Induced Melanogenesis in B16F10 Melanoma Cells
,Nam, JH;Nam, DY;Lee, DU;,
J. Nat. Prod.
,PubMed ID 26967731
[ORAI1]
|
|
POST, partner of stromal interaction molecule 1 (STIM1), targets STIM1 to multiple transporters
,null,
Proceedings of the National Academy of Sciences of the United States of America
,PubMed ID 22084111
[ORAI1]
|
|
Mitofusin 2 Regulates STIM1 Migration from the Ca2+ Store to the Plasma Membrane in Cells with Depolarized Mitochondria
,Karthika Singaravelu, Charmaine Nelson, Daniel Bakowski, Olga Martins de Brito, Siaw-Wei Ng, Joseph Di Capite, Trevor Powell, Luca Scorrano, and Anant B. Parekh,
J. Biol. Chem., Apr 2011; 286: 12189 - 12201
[Orai1]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC210034L1 | Lenti ORF clone of Human ORAI calcium release-activated calcium modulator 1 (ORAI1), Myc-DDK-tagged |
CNY 6,000.00 |
|
| RC210034L2 | Lenti ORF clone of Human ORAI calcium release-activated calcium modulator 1 (ORAI1), mGFP tagged |
CNY 6,000.00 |
|
| RC210034L3 | Lenti ORF clone of Human ORAI calcium release-activated calcium modulator 1 (ORAI1), Myc-DDK-tagged |
CNY 5,890.00 |
|
| RC210034L4 | Lenti ORF clone of Human ORAI calcium release-activated calcium modulator 1 (ORAI1), mGFP tagged |
CNY 6,000.00 |
|
| RG210034 | ORAI1 (tGFP-tagged) - Human ORAI calcium release-activated calcium modulator 1 (ORAI1) |
CNY 5,200.00 |
|
| SC316298 | ORAI1 (untagged)-Human ORAI calcium release-activated calcium modulator 1 (ORAI1) |
CNY 3,600.00 |
|
| SC321019 | ORAI1 (untagged)-Human ORAI calcium release-activated calcium modulator 1 (ORAI1) |
CNY 3,600.00 |
