BCL10 (NM_003921) Human Tagged ORF Clone
CAT#: RC208752
BCL10 (Myc-DDK-tagged)-Human B-cell CLL/lymphoma 10 (BCL10)
ORF Plasmid: tGFP
"NM_003921" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | c-E10; CARMEN; CIPER; CLAP; IMD37; mE10 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC208752 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGCCCACCGCACCGTCCCTCACCGAGGAGGACCTCACTGAAGTGAAGAAGGACGCCTTAGAAAATT TACGTGTATACCTGTGTGAGAAAATCATAGCTGAGAGACATTTTGATCATCTACGTGCAAAAAAAATACT CAGTAGAGAAGACACTGAAGAAATTTCTTGTCGAACATCAAGTAGAAAAAGGGCTGGAAAATTGTTAGAC TACTTACAGGAAAACCCAAAAGGTCTGGACACCCTTGTTGAATCTATTCGGCGAGAAAAAACACAGAACT TCCTGATACAGAAGATTACAGATGAAGTGCTGAAACTTAGAAATATAAAACTAGAACATCTGAAAGGACT AAAATGTAGCAGTTGTGAACCTTTTCCAGATGGAGCCACGAACAACCTCTCCAGATCAAATTCAGATGAG AGTAATTTCTCTGAAAAACTGAGGGCATCCACTGTCATGTACCATCCAGAAGGAGAATCCAGCACGACGC CCTTTTTTTCTACTAATTCTTCTCTGAATTTGCCTGTTCTAGAAGTAGGCAGAACTGAAAATACCATCTT CTCTTCAACTACACTTCCCAGACCTGGGGACCCAGGGGCTCCTCCTTTGCCACCAGATCTACAGTTAGAA GAAGAAGGAACTTGTGCAAACTCTAGTGAGATGTTTCTTCCCTTAAGATCACGTACTGTTTCACGACAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC208752 protein sequence
Red=Cloning site Green=Tags(s) MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLD YLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDE SNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGAPPLPPDLQLE EEGTCANSSEMFLPLRSRTVSRQ myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_003921 |
ORF Size | 699 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_003921.5 |
RefSeq Size | 3118 bp |
RefSeq ORF | 702 bp |
Locus ID | 8915 |
UniProt ID | O95999 |
Domains | CARD |
Protein Families | Druggable Genome |
Protein Pathways | B cell receptor signaling pathway, T cell receptor signaling pathway |
MW | 26.3 kDa |
Gene Summary | This gene was identified by its translocation in a case of mucosa-associated lymphoid tissue (MALT) lymphoma. The protein encoded by this gene contains a caspase recruitment domain (CARD), and has been shown to induce apoptosis and to activate NF-kappaB. This protein is reported to interact with other CARD domain containing proteins including CARD9, 10, 11 and 14, which are thought to function as upstream regulators in NF-kappaB signaling. This protein is found to form a complex with MALT1, a protein encoded by another gene known to be translocated in MALT lymphoma. MALT1 and this protein are thought to synergize in the activation of NF-kappaB, and the deregulation of either of them may contribute to the same pathogenetic process that leads to the malignancy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Impaired RASGRF1/ERK-mediated GM-CSF response characterizes CARD9 deficiency in French-Canadians
,Gavino, C;Hamel, N;Zeng, JB;Legault, C;Guiot, MC;Chankowsky, J;Lejtenyi, D;Lemire, M;Alarie, I;Dufresne, S;Boursiquot, JN;McIntosh, F;Langelier, M;Behr, MA;Sheppard, DC;Foulkes, WD;Vinh, DC;,
J. Allergy Clin. Immunol.
,PubMed ID 26521038
[BCL10]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC208752L1 | Lenti ORF clone of Human B-cell CLL/lymphoma 10 (BCL10), Myc-DDK-tagged |
CNY 6,000.00 |
|
RC208752L2 | Lenti ORF clone of Human B-cell CLL/lymphoma 10 (BCL10), mGFP tagged |
CNY 5,890.00 |
|
RC208752L3 | Lenti ORF clone of Human B-cell CLL/lymphoma 10 (BCL10), Myc-DDK-tagged |
CNY 6,000.00 |
|
RC208752L4 | Lenti ORF clone of Human B-cell CLL/lymphoma 10 (BCL10), mGFP tagged |
CNY 6,000.00 |
|
RG208752 | BCL10 (tGFP-tagged) - Human B-cell CLL/lymphoma 10 (BCL10) |
CNY 5,200.00 |
|
SC117685 | BCL10 (untagged)-Human B-cell CLL/lymphoma 10 (BCL10) |
CNY 3,600.00 |