HMG1 (HMGB1) (NM_002128) Human Tagged ORF Clone
CAT#: RC205918
HMGB1 (Myc-DDK-tagged)-Human high mobility group box 1 (HMGB1)
ORF Plasmid: tGFP
"NM_002128" in other vectors (7)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
Cited in 4 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | HMG-1; HMG1; HMG3; SBP-1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC205918 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGCAAAGGAGATCCTAAGAAGCCGAGAGGCAAAATGTCATCATATGCATTTTTTGTGCAAACTTGTC GGGAGGAGCATAAGAAGAAGCACCCAGATGCTTCAGTCAACTTCTCAGAGTTTTCTAAGAAGTGCTCAGA GAGGTGGAAGACCATGTCTGCTAAAGAGAAAGGAAAATTTGAAGATATGGCAAAAGCGGACAAGGCCCGT TATGAAAGAGAAATGAAAACCTATATCCCTCCCAAAGGGGAGACAAAAAAGAAGTTCAAGGATCCCAATG CACCCAAGAGGCCTCCTTCGGCCTTCTTCCTCTTCTGCTCTGAGTATCGCCCAAAAATCAAAGGAGAACA TCCTGGCCTGTCCATTGGTGATGTTGCGAAGAAACTGGGAGAGATGTGGAATAACACTGCTGCAGATGAC AAGCAGCCTTATGAAAAGAAGGCTGCGAAGCTGAAGGAAAAATACGAAAAGGATATTGCTGCATATCGAG CTAAAGGAAAGCCTGATGCAGCAAAAAAGGGAGTTGTCAAGGCTGAAAAAAGCAAGAAAAAGAAGGAAGA GGAGGAAGATGAGGAAGATGAAGAGGATGAGGAGGAGGAGGAAGATGAAGAAGATGAAGATGAAGAAGAA GATGATGATGATGAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC205918 protein sequence
Red=Cloning site Green=Tags(s) MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKAR YEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADD KQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEE DDDDE myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002128 |
ORF Size | 645 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_002128.6 |
RefSeq Size | 3428 bp |
RefSeq ORF | 648 bp |
Locus ID | 3146 |
UniProt ID | P09429 |
Domains | HMG |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Base excision repair |
MW | 24.9 kDa |
Gene Summary | This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015] |
Citations (4)
The use of this cDNA Clones has been cited in the following citations: |
---|
In situ visualizing the recognition between proteins and platinum-damaged DNA in single-cells by correlated optical and secondary ion mass spectrometric imaging
,Lin, Y;Wu, K;Jia, F;Chen, L;Wang, Z;Zhang, Y;Luo, Q;,
Conference
[HMG1]
|
microRNA-548b suppresses aggressive phenotypes of hepatocellular carcinoma by directly targeting high-mobility group box 1 mRNA
,Yun, Z;Meng, F;Jiang, P;Yue, M;Li, S;,
CMAR
,PubMed ID 31417317
[HMG1]
|
Unfractionated Heparin Alleviates Human Lung Endothelial Barrier Dysfunction Induced by High Mobility Group Box 1 Through Regulation of P38-GSK3β-Snail Signaling Pathway
,Luan, Z;Hu, B;Wu, L;Jin, S;Ma, X;Zhang, J;Wang, A;,
Cell. Physiol. Biochem.
,PubMed ID 29719300
[HMG1]
|
Delineating the HMGB1 and HMGB2 interactome in prostate and ovary epithelial cells and its relationship with cancer
,Barreiro-Alonso, A;Lamas-Maceiras, M;García-Díaz, R;Rodríguez-Belmonte, E;Yu, L;Pardo, M;Choudhary, J;Cerdán, M;,
Oncotarget
,PubMed ID 29721183
[HMG1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC205918L1 | Lenti ORF clone of Human high mobility group box 1 (HMGB1), Myc-DDK-tagged |
CNY 6,000.00 |
|
RC205918L2 | Lenti ORF clone of Human high mobility group box 1 (HMGB1), mGFP tagged |
CNY 6,000.00 |
|
RC205918L3 | Lenti ORF clone of Human high mobility group box 1 (HMGB1), Myc-DDK-tagged |
CNY 6,000.00 |
|
RC205918L4 | Lenti ORF clone of Human high mobility group box 1 (HMGB1), mGFP tagged |
CNY 6,000.00 |
|
RG205918 | HMGB1 (tGFP-tagged) - Human high mobility group box 1 (HMGB1) |
CNY 5,200.00 |
|
SC118802 | HMGB1 (untagged)-Human high mobility group box 1 (HMGB1) |
CNY 3,600.00 |
|
SC324540 | HMGB1 (untagged)-Human high mobility group box 1 (HMGB1) |
CNY 3,600.00 |