MIF (NM_002415) Human Tagged ORF Clone
CAT#: RC205106
MIF (Myc-DDK-tagged)-Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF)
ORF Plasmid: tGFP
"NM_002415" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | GIF; GLIF; MMIF |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC205106 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCGATGTTCATCGTAAACACCAACGTGCCCCGCGCCTCCGTGCCGGACGGGTTCCTCTCCGAGCTCA CCCAGCAGCTGGCGCAGGCCACCGGCAAGCCCCCCCAGTACATCGCGGTGCACGTGGTCCCGGACCAGCT CATGGCCTTCGGCGGCTCCAGCGAGCCGTGCGCGCTCTGCAGCCTGCACAGCATCGGCAAGATCGGCGGC GCGCAGAACCGCTCCTACAGCAAGCTGCTGTGCGGCCTGCTGGCCGAGCGCCTGCGCATCAGCCCGGACA GGGTCTACATCAACTATTACGACATGAACGCGGCCAATGTGGGCTGGAACAACTCCACCTTCGCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC205106 protein sequence
Red=Cloning site Green=Tags(s) MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGG AQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002415 |
ORF Size | 345 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_002415.2 |
RefSeq Size | 561 bp |
RefSeq ORF | 348 bp |
Locus ID | 4282 |
UniProt ID | P14174 |
Domains | MIF |
Protein Families | Druggable Genome |
Protein Pathways | Phenylalanine metabolism, Tyrosine metabolism |
MW | 12.5 kDa |
Gene Summary | This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Macrophage migration inhibitory factor downregulation: a novel mechanism of resistance to anti-angiogenic therapy
,Castro, BA;Flanigan, P;Jahangiri, A;Hoffman, D;Chen, W;Kuang, R;De Lay, M;Yagnik, G;Wagner, JR;Mascharak, S;Sidorov, M;Shrivastav, S;Kohanbash, G;Okada, H;Aghi, MK;,
Oncogene
,PubMed ID 28218903
[MIF]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC205106L1 | Lenti ORF clone of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC205106L2 | Lenti ORF clone of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), mGFP tagged |
CNY 5,890.00 |
|
RC205106L3 | Lenti ORF clone of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC205106L4 | Lenti ORF clone of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), mGFP tagged |
CNY 3,600.00 |
|
RG205106 | MIF (tGFP-tagged) - Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF) |
CNY 2,800.00 |
|
SC118641 | MIF (untagged)-Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF) |
CNY 1,200.00 |