D4 (ARHGDIB) (NM_001175) Human Tagged ORF Clone
CAT#: RC203496
ARHGDIB (Myc-DDK-tagged)-Human Rho GDP dissociation inhibitor (GDI) beta (ARHGDIB)
ORF Plasmid: tGFP
"NM_001175" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | D4; GDIA2; GDID4; Ly-GDI; LYGDI; RAP1GN1; RhoGDI2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC203496 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACTGAAAAAGCCCCAGAGCCACATGTGGAGGAGGATGACGATGATGAGCTGGACAGCAAGCTCAATT ATAAGCCTCCACCACAGAAGTCCCTGAAAGAGCTGCAGGAAATGGACAAAGATGATGAGAGTCTAATTAA GTACAAGAAAACGCTGCTGGGAGATGGTCCTGTGGTGACAGATCCGAAAGCCCCCAATGTCGTTGTCACC CGGCTCACCCTGGTTTGTGAGAGTGCCCCGGGACCAATCACCATGGACCTTACTGGAGATCTGGAAGCCC TCAAAAAGGAAACCATTGTGTTAAAGGAAGGTTCTGAATATAGAGTCAAAATTCACTTCAAAGTGAACAG GGATATTGTGTCAGGCCTGAAATACGTTCAGCACACCTACAGGACTGGGGTGAAAGTGGATAAAGCAACA TTTATGGTTGGCAGCTATGGACCTCGGCCTGAGGAGTATGAGTTCCTCACTCCAGTTGAGGAGGCTCCCA AGGGCATGCTGGCCCGAGGCACGTACCACAACAAGTCCTTCTTCACCGACGATGACAAGCAAGACCACCT CAGCTGGGAGTGGAACCTGTCGATTAAGAAGGAGTGGACAGAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC203496 protein sequence
Red=Cloning site Green=Tags(s) MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVT RLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKAT FMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001175 |
ORF Size | 603 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_001175.2 |
RefSeq Size | 1216 bp |
RefSeq ORF | 606 bp |
Locus ID | 397 |
UniProt ID | P52566 |
Domains | Rho_GDI |
Protein Families | Druggable Genome |
Protein Pathways | Neurotrophin signaling pathway |
MW | 23 kDa |
Gene Summary | Members of the Rho (or ARH) protein family (see MIM 165390) and other Ras-related small GTP-binding proteins (see MIM 179520) are involved in diverse cellular events, including cell signaling, proliferation, cytoskeletal organization, and secretion. The GTP-binding proteins are active only in the GTP-bound state. At least 3 classes of proteins tightly regulate cycling between the GTP-bound and GDP-bound states: GTPase-activating proteins (GAPs), guanine nucleotide-releasing factors (GRFs), and GDP-dissociation inhibitors (GDIs). The GDIs, including ARHGDIB, decrease the rate of GDP dissociation from Ras-like GTPases (summary by Scherle et al., 1993 [PubMed 8356058]).[supplied by OMIM, Dec 2010] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
EphrinB1 promotes cancer cell migration and invasion through the interaction with RhoGDI1
,Cho, HJ;Hwang, YS;Yoon, J;Lee, M;Lee, HG;Daar, IO;,
Oncogene
,PubMed ID 29059157
[D4]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC203496L1 | Lenti ORF clone of Human Rho GDP dissociation inhibitor (GDI) beta (ARHGDIB), Myc-DDK-tagged |
CNY 6,000.00 |
|
RC203496L2 | Lenti ORF clone of Human Rho GDP dissociation inhibitor (GDI) beta (ARHGDIB), mGFP tagged |
CNY 6,000.00 |
|
RC203496L3 | Lenti ORF clone of Human Rho GDP dissociation inhibitor (GDI) beta (ARHGDIB), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC203496L4 | Lenti ORF clone of Human Rho GDP dissociation inhibitor (GDI) beta (ARHGDIB), mGFP tagged |
CNY 5,890.00 |
|
RG203496 | ARHGDIB (tGFP-tagged) - Human Rho GDP dissociation inhibitor (GDI) beta (ARHGDIB) |
CNY 5,200.00 |
|
SC127108 | ARHGDIB (untagged)-Human Rho GDP dissociation inhibitor (GDI) beta (ARHGDIB) |
CNY 2,400.00 |