United States
Germany
Japan
United Kingdom
China
SOD2 (NM_000636) Human Tagged ORF Clone
CAT＃: RC202330
- TrueORF®
SOD2 (Myc-DDK-tagged)-Human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1
ORF Plasmid: tGFP
"NM_000636" in other vectors (7)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
| Cited in 13 publications. |
Product images
CNY 300.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | GClnc1; IPO-B; IPOB; Mn-SOD; MNSOD; MVCD6 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC202330 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTTGAGCCGGGCAGTGTGCGGCACCAGCAGGCAGCTGGCTCCGGTTTTGGGGTATCTGGGCTCCAGGC AGAAGCACAGCCTCCCCGACCTGCCCTACGACTACGGCGCCCTGGAACCTCACATCAACGCGCAGATCAT GCAGCTGCACCACAGCAAGCACCACGCGGCCTACGTGAACAACCTGAACGTCACCGAGGAGAAGTACCAG GAGGCGTTGGCCAAGGGAGATGTTACAGCCCAGATAGCTCTTCAGCCTGCACTGAAGTTCAATGGTGGTG GTCATATCAATCATAGCATTTTCTGGACAAACCTCAGCCCTAACGGTGGTGGAGAACCCAAAGGGGAGTT GCTGGAAGCCATCAAACGTGACTTTGGTTCCTTTGACAAGTTTAAGGAGAAGCTGACGGCTGCATCTGTT GGTGTCCAAGGCTCAGGTTGGGGTTGGCTTGGTTTCAATAAGGAACGGGGACACTTACAAATTGCTGCTT GTCCAAATCAGGATCCACTGCAAGGAACAACAGGCCTTATTCCACTGCTGGGGATTGATGTGTGGGAGCA CGCTTACTACCTTCAGTATAAAAATGTCAGGCCTGATTATCTAAAAGCTATTTGGAATGTAATCAACTGG GAGAATGTAACTGAAAGATACATGGCTTGCAAAAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202330 protein sequence
Red=Cloning site Green=Tags(s) MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQ EALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASV GVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINW ENVTERYMACKK myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_000636 |
| ORF Size | 666 bp |
| OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_000636.4 |
| RefSeq Size | 1593 bp |
| RefSeq ORF | 669 bp |
| Locus ID | 6648 |
| UniProt ID | P04179 |
| Domains | sodfe |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Huntington's disease |
| MW | 24.8 kDa |
| Gene Summary | This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 1. [provided by RefSeq, Apr 2016] |
Citations (13)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
Targeting prooxidant MnSOD effect inhibits triple-negative breast cancer (TNBC) progression and M2 macrophage functions under the oncogenic stress
,null,
Cell Death & Disease
,PubMed ID 35017469
[SOD2]
|
|
Long non-coding RNA GClnc1 knockdown suppresses progression of epithelial ovarian cancer by recruiting FOXC2 to disrupt the NOTCH1/NF-κB/Snail pathway
,Wu, D;Ke, Y;Xiao, R;Liu, J;Li, Q;Wang, Y;,
Experimental cell research
,PubMed ID 33338479
[SOD2]
|
|
Inhibition of lung cancer by 2-methoxy-6-acetyl-7-methyljuglone (MAM) through induction of necroptosis by targeting receptor-interacting protein 1 (RIP1)
,Sun, W;Yu, J;Gao, H;Wu, X;Wang, S;Hou, Y;Lu, JJ;Chen, X;,
Antioxid. Redox Signal.
,PubMed ID 30556404
[SOD2]
|
|
MnSOD mediates shear stress-promoted tumor cell migration and adhesion
,Ma, S;Fu, A;Lim, S;Chiew, GGY;Luo, KQ;,
Free Radic. Biol. Med.
,PubMed ID 30193891
[SOD2]
|
|
DNA Methylation-a Potential Source of Mitochondria DNA Base Mismatch in the Development of Diabetic Retinopathy
,Mishra, M;Kowluru, RA;,
Mol. Neurobiol.
,PubMed ID 29679259
[SOD2]
|
|
Syntaphilin controls a mitochondrial rheostat for proliferation-motility decisions in cancer
,null,
The Journal of Clinical Investigation
,PubMed ID 28891816
[SOD2]
|
|
A Small Molecule Activator of SIRT3 Promotes Deacetylation and Activation of Manganese Superoxide Dismutase
,Lu, J;Zhang, H;Chen, X;Zou, Y;Li, J;Wang, L;Wu, M;Zang, J;Yu, Y;Zhuang, W;Xia, Q;Wang, J;,
Free Radic. Biol. Med.
,PubMed ID 28711502
[SOD2]
|
|
Cytosolic calcium mediates RIP1/RIP3 complex-dependent necroptosis through JNK activation and mitochondrial ROS production in human colon cancer cells
,Sun, W;Wu, X;Gao, H;Yu, J;Zhao, W;Lu, JJ;Wang, J;Du, G;Chen, X;,
Free Radic. Biol. Med.
,PubMed ID 28414098
[SOD2]
|
|
A neuronal network of mitochondrial dynamics regulates metastasis
,Caino, MC;Seo, JH;Aguinaldo, A;Wait, E;Bryant, KG;Kossenkov, AV;Hayden, JE;Vaira, V;Morotti, A;Ferrero, S;Bosari, S;Gabrilovich, DI;Languino, LR;Cohen, AR;Altieri, DC;,
Nat Commun
,PubMed ID 27991488
[SOD2]
|
|
Novel mechanisms for superoxide-scavenging activity of Human manganese superoxide dismutase (SOD2) determined by K68 key acetylation site
,Lu, J;Cheng, K;Zhang, B;Xu, H;Cao, Y;Guo, F;Feng, X;Xia, Q;,
Free Radic. Biol. Med.
,PubMed ID 25908444
[SOD2]
|
|
Role of reactive oxygen species in arsenic-induced transformation of human lung bronchial epithelial (BEAS-2B) cells
,Zhang, Z;Pratheeshkumar, P;Budhraja, A;Son, YO;Kim, D;Shi, X;,
Biochem. Biophys. Res. Commun.
,PubMed ID 25499816
[SOD2]
|
|
The Dual Roles of c-Jun NH2-Terminal Kinase Signaling in Cr(VI)-Induced Apoptosis in JB6 Cells
,Young-Ok Son, John Andrew Hitron, Senping Cheng, Amit Budhraja, Zhuo Zhang, Nancy Lan Guo, Jeong-Chae Lee, and Xianglin Shi,
Toxicol. Sci., Feb 2011; 119: 335 - 345
[SOD2]
|
|
MicroRNA-target pairs in human renal epithelial cells treated with transforming growth factor ß1: a novel role of miR-382
,Alison J. Kriegel, Yi Fang, Yong Liu, Zhongmin Tian, Domagoj Mladinov, Isaac R. Matus, Xiaoqiang Ding, Andrew S. Greene, and Mingyu Liang,
Nucleic Acids Res., Aug 2010; 10.1093/nar/gkq718
[SOD2]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC202330L1 | Lenti ORF clone of Human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged |
CNY 6,000.00 |
|
| RC202330L2 | Lenti ORF clone of Human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
| RC202330L3 | Lenti ORF clone of Human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged |
CNY 6,000.00 |
|
| RC202330L4 | Lenti ORF clone of Human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged |
CNY 6,000.00 |
|
| RG202330 | SOD2 (tGFP-tagged) - Human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 5,200.00 |
|
| SC127816 | SOD2 (untagged)-Human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,600.00 |
|
| SC323760 | SOD2 (untagged)-Human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,600.00 |
