Rspo3 (NM_028351) Mouse Tagged ORF Clone

CAT#: MR218621

  • TrueORF®

Rspo3 (Myc-DDK-tagged) - Mouse R-spondin 3 homolog (Xenopus laevis) (Rspo3)

ORF Plasmid: DDK tGFP



  "NM_028351" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,600.00


货期*
现货

规格
    • 10 ug

Cited in 1 publication.

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


RSPO3 Antibody - middle region
    • 50 ug

CNY 4,628.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 2810459H04Rik; AW742308; Cristin1; Thsd2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR218621 representing NM_028351
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACTTGCGACTGATTTCTTGTTTTTTTATCATTTTGAACTTTATGGAATACATTGGCAGCCAAAACG
CCTCCCGAGGAAGGCGCCAGCGAAGAATGCATCCTAATGTCAGTCAAGGCTGCCAAGGAGGCTGTGCAAC
GTGTTCAGATTACAATGGCTGTTTGTCATGTAAGCCCAGACTGTTTTTTGTTCTGGAAAGGATTGGCATG
AAGCAGATAGGAGTGTGTCTCTCTTCGTGTCCAAGTGGATATTACGGAACTCGATATCCAGATATAAATA
AATGTACAAAATGCAAAGTTGACTGTGATACCTGTTTCAACAAAAATTTCTGCACAAAGTGTAAAAGTGG
ATTTTACTTACACCTTGGAAAGTGCCTTGACAGTTGCCCAGAAGGGTTAGAAGCCAACAATCATACTATG
GAATGTGTCAGTATTGTACACTGTGAGGCCAGTGAATGGAGTCCATGGAGTCCATGTATGAAGAAAGGAA
AAACATGTGGCTTCAAAAGGGGGACTGAAACACGGGTCCGAGATATACTACAGCATCCTTCAGCCAAGGG
TAACCTGTGCCCCCCAACCAGCGAGACAAGAACTTGTATAGTACAAAGAAAGAAGTGTTCAAAGGGAGAG
CGAGGAAAAAAGGGAAGAGAGAGAAAACGAAAAAAACTGAATAAAGAAGAAAGAAAGGAAACAAGCTCCT
CCTCTGACAGCAAAGGTTTGGAGTCCAGCATTGAGACCCCAGACCAGCAGGAAAACAAAGAGAGGCAGCA
GCAGCAGAAGAGAAGAGCCCGAGACAAGCAACAGAAATCGGTATCAGTCAGCACTGTACAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR218621 representing NM_028351
Red=Cloning site Green=Tags(s)

MHLRLISCFFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFVLERIGM
KQIGVCLSSCPSGYYGTRYPDINKCTKCKVDCDTCFNKNFCTKCKSGFYLHLGKCLDSCPEGLEANNHTM
ECVSIVHCEASEWSPWSPCMKKGKTCGFKRGTETRVRDILQHPSAKGNLCPPTSETRTCIVQRKKCSKGE
RGKKGRERKRKKLNKEERKETSSSSDSKGLESSIETPDQQENKERQQQQKRRARDKQQKSVSVSTVH

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_028351
ORF Size 831 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_028351.3, NP_082627.3
RefSeq Size 2411 bp
RefSeq ORF 834 bp
Locus ID 72780
UniProt ID Q2TJ95
MW 31.9 kDa
Gene Summary Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors, which acts as a key regulator of angiogenesis (PubMed:16543246, PubMed:21693646, PubMed:26766444). Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. Also regulates the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway (PubMed:16543246, PubMed:21693646). Acts as a key regulator of angiogenesis by controlling vascular stability and pruning: acts by activating the non-canonical Wnt signaling pathway in endothelial cells (PubMed:26766444, PubMed:16543246, PubMed:21693646). Can also amplify Wnt signaling pathway independently of LGR4-6 receptors, possibly by acting as a direct antagonistic ligand to RNF43 and ZNRF3 (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Other Versions

Customer Reviews 
Loading...