Cep290 (BC004690) Mouse Tagged ORF Clone
CAT#: MR209644
- TrueORF®
Cep290 (Myc-DDK-tagged) - Mouse centrosomal protein 290 (cDNA clone MGC:7859 IMAGE:3501291)
ORF Plasmid: tGFP
"BC004690" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CN¥ 6,370.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | MGC7859 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR209644 representing BC004690
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCTGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR209644 representing BC004690
Red=Cloning site Green=Tags(s) MEQTVAEQDDSLSSLLTKLKKVSKDLEKQKEITELKVREFENTKLRLQETHASEVKKVKAEVEDLRHALA QAHKDSQSLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRSEMTAAAEERIIA VTSQKEANLNVQQVVERHTRELKSQIEDLNENLLKLKEALKTSKNKENSLADDLNELNNELQKKQKAYNK ILREKDGIDQENDELRRQIKRLSSGLQSKTLIDNKQSLIDELQKKVKKLESQLERKVDDVDIKPVKEKSS KEELIRWEEGKKWQTKVEGLRNRLKEKEGEAHGLAKQLNTLKELFAKADKEKLTLQKKLKTTGMTVDQVL GVRALESEKELEELKKKNLDLENDILYMRTQQALPRDSVVEDLHLQNKYLQEKLHTLEKKLSKEKIVAEN ERLRKELKKEIEASEKLRIAKNNLELVNDKMAAQLEETGKRLQFAESRAPQLEGADSKSWKSIVVSRVYE TKMKELESDIAKKNQSITDLKQLVREATEREQKAKKYTEDLEQQIEILKNVPEGAETEQELIRELQLLRL ANNQLDKERAELIHQIEINKDQTRADSSIPDSDQLKEKINDLETQLRKLELEKQHSKEEVKKLKKELENF DPSFF myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | BC004690 |
ORF Size | 97 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | BC004690, AAH04690 |
RefSeq Size | 2831 bp |
RefSeq ORF | 1907 bp |
Locus ID | 216274 |
MW | 103.7 kDa |
Gene Summary | Involved in early and late steps in cilia formation (PubMed:21565611). Its association with CCP110 is required for inhibition of primary cilia formation by CCP110 (By similarity). May play a role in early ciliogenesis in the disappearance of centriolar satellites and in the transition of primary ciliar vesicles (PCVs) to capped ciliary vesicles (CCVs). Required for the centrosomal recruitment of RAB8A and for the targeting of centriole satellite proteins to centrosomes such as of PCM1 (By similarity). Required for the correct localization of ciliary and phototransduction proteins in retinal photoreceptor cells; may play a role in ciliary transport processes (PubMed:16632484). Required for efficient recruitment of RAB8A to primary cilium (By similarity). In the ciliary transition zone is part of the tectonic-like complex (also named B9 complex) which is required for tissue-specific ciliogenesis and may regulate ciliary membrane composition (PubMed:21725307). Involved in regulation of the BBSome complex integrity, specifically for presence of BBS2, BBS5 and BBS8/TTC8 in the complex, and in ciliary targeting of selected BBSome cargos. May play a role in controlling entry of the BBSome complex to cilia possibly implicating IQCB1/NPHP5 (By similarity). Activates ATF4-mediated transcription (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC218579 | Cep290 (untagged) - Mouse centrosomal protein 290 (cDNA clone MGC:7859 IMAGE:3501291), (10ug) |
CN¥ 6,940.00 |
|
MG209644 | Cep290 (tGFP-tagged) - Mouse centrosomal protein 290 (cDNA clone MGC:7859 IMAGE:3501291) |
CN¥ 9,168.00 |
|
MR209644L3 | Lenti ORF clone of Cep290 (Myc-DDK-tagged) - Mouse centrosomal protein 290 (cDNA clone MGC:7859 IMAGE:3501291) |
CN¥ 8,270.00 |
|
MR209644L4 | Lenti ORF clone of Cep290 (mGFP-tagged) - Mouse centrosomal protein 290 (cDNA clone MGC:7859 IMAGE:3501291) |
CN¥ 8,270.00 |