Vps26b (NM_178027) Mouse Tagged ORF Clone

CAT#: MR204988

  • TrueORF®

Vps26b (Myc-DDK-tagged) - Mouse vacuolar protein sorting 26 homolog B (yeast) (Vps26b)

ORF Plasmid: DDK tGFP



  "NM_178027" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 5,488.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 1810012I05Rik; 2310075A12Rik; AI848392
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR204988 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCTTCTTCGGCTTCGGGCAGAGCGTGGAGGTGGAAATCTTGCTGAATGATGCGGAGAGTAGGAAGC
GAGCGGAGCACAAGACTGAGGACGGGAAGAAGGAGAAATATTTCCTCTTCTACGACGGGGAAACCGTCTC
GGGGAAAGTGAGCCTATCACTGAAGAACCCCAACAAGCGACTAGAGCACCAGGGCATCAAGATCGAGTTC
ATTGGGCAGATCGAACTCTACTATGACCGTGGGAACCACCATGAGTTTGTGTCTTTGGTGAAGGACCTGG
CTCGGCCAGGAGAGATCACCCAATCGCAGGCCTTCGACTTTGAGTTCACCCATGTGGAAAAGCCGTATGA
ATCCTACACAGGACAGAATGTGAAGCTCCGCTATTTCCTTCGAGCCACCATCAGCCGCCGCCTCAATGAT
GTTGTTAAAGAGATGGACATTGTAGTTCACACACTTAGCACATACCCCGAGCTGAACTCATCCATCAAGA
TGGAAGTTGGCATTGAGGATTGCCTGCACATTGAATTTGAGTACAACAAATCCAAATACCACTTGAAAGA
TGTCATTGTAGGGAAGATATACTTCCTGCTGGTGAGAATCAAGATCAAGCACATGGAGATAGACATCATC
AAACGAGAGACAACAGGCACGGGTCCCAACGTGTACCACGAGAACGACACAATAGCGAAGTATGAGATCA
TGGACGGGGCACCAGTCCGAGGTGAGTCCATCCCCATCAGGCTCTTCCTGGCAGGGTATGAGCTCACACC
CACCATGCGTGACATAAATAAGAAGTTCTCTGTGCGCTATTACCTCAACTTGGTGCTGATAGATGAGGAG
GAACGGCGCTACTTCAAGCAGCAGGAAGTGGTGTTGTGGCGGAAGGGTGACATCGTACGGAAGAGCATGT
CCCACCAGGCAGCCATTGCCTCACAGCGCTTCGAGGGCACAACCTCCCTGGGTGAGGTGCGGACCCCTGG
CCAACTGTCTGACAACAACAGCAGGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR204988 protein sequence
Red=Cloning site Green=Tags(s)

MSFFGFGQSVEVEILLNDAESRKRAEHKTEDGKKEKYFLFYDGETVSGKVSLSLKNPNKRLEHQGIKIEF
IGQIELYYDRGNHHEFVSLVKDLARPGEITQSQAFDFEFTHVEKPYESYTGQNVKLRYFLRATISRRLND
VVKEMDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIKHMEIDII
KRETTGTGPNVYHENDTIAKYEIMDGAPVRGESIPIRLFLAGYELTPTMRDINKKFSVRYYLNLVLIDEE
ERRYFKQQEVVLWRKGDIVRKSMSHQAAIASQRFEGTTSLGEVRTPGQLSDNNSRQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_178027
ORF Size 1011 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_178027.4
RefSeq Size 6890 bp
RefSeq ORF 1011 bp
Locus ID 69091
UniProt ID Q8C0E2
MW 39.1 kDa
Gene Summary Acts as component of the retromer cargo-selective complex (CSC) (PubMed:21040701, PubMed:21920005). The CSC is believed to be the core functional component of retromer or respective retromer complex variants acting to prevent missorting of selected transmembrane cargo proteins into the lysosomal degradation pathway. The recruitment of the CSC to the endosomal membrane involves RAB7A and SNX3. The SNX-BAR retromer mediates retrograde transport of cargo proteins from endosomes to the trans-Golgi network (TGN) and is involved in endosome-to-plasma membrane transport for cargo protein recycling. The SNX3-retromer mediates the retrograde transport of WLS distinct from the SNX-BAR retromer pathway. The SNX27-retromer is believed to be involved in endosome-to-plasma membrane trafficking and recycling of a broad spectrum of cargo proteins. The CSC seems to act as recruitment hub for other proteins, such as the WASH complex and TBC1D5 (By similarity). May be involved in retrograde transport of SORT1 but not of IGF2R (PubMed:21040701). Acts redundantly with VSP26A in SNX-27 mediated endocytic recycling of SLC2A1/GLUT1 (PubMed:25136126).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...