Neil1 (BC043297) Mouse Tagged ORF Clone

CAT#: MR203232

  • TrueORF®

Neil1 (Myc-DDK-tagged) - Mouse nei endonuclease VIII-like 1 (E. coli) (cDNA clone MGC:49102 IMAGE:5320651)

ORF Plasmid: DDK tGFP



  "BC043297" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00

CNY 6,365.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 2810450N13Rik; Nei1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR203232 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAGAGGGCCCAGAGCTGCACCTGGCCAGCCACTTTGTGAATGAGACATGTAAGGGGCTGGTATTTG
GTGGGTGTGTGGAGAAGTCCTCTGTCAGCCGGAACCCGGAGGTGCCCTTTGAGAGCAGTGCCTACCACAT
CTCAGCTTTAGCCCGAGGCAAGGAGCTGCGCTTGACATTGAGCCCCCTGCCTGGGTCCCAGCCCCCTCAG
AAGCCACTGTCCCTTGTCTTCCGCTTTGGGATGTCAGGATCCTTCCAGCTGGTACCCGCAGAGGCACTGC
CCCGCCACGCCCATCTACGTTTTTACACAGCCCCACCTGCTCCCCGGCTTGCCCTTTGCTTCGTAGACAT
CCGTCGCTTTGGCCACTGGGATCCTGGGGGTGAATGGCAACCAGGCCGTGGACCCTGTGTCTTGCTGGAG
TATGAACGGTTCAGAGAGAACGTACTTCGGAACCTATCAGACAAAGCCTTTGACCGGCCCATCTGCGAGG
CCTTGTTGGACCAGAGGTTCTTCAATGGCATTGGCAACTATCTGCGGGCAGAGATCCTGTACCGGCTGAA
GATCCCTCCTTTTGAGAAGGCTCGTACAGTTCTAGAGGCCCTGCAACAGTGCCGGCCGAGCCCAGAGCTG
ACCCTGAGCCAGAAGATCAAGGCCAAACTACAGAACCCAGACCTGCTGGAACTGTGTCACTTGGTGCCCA
AGGAAGTGGTTCAGCTGGGTGAGGCCTGGGGAGGTCAAGATGGCCGGCGGCCTCTACCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR203232 protein sequence
Red=Cloning site Green=Tags(s)

MPEGPELHLASHFVNETCKGLVFGGCVEKSSVSRNPEVPFESSAYHISALARGKELRLTLSPLPGSQPPQ
KPLSLVFRFGMSGSFQLVPAEALPRHAHLRFYTAPPAPRLALCFVDIRRFGHWDPGGEWQPGRGPCVLLE
YERFRENVLRNLSDKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIPPFEKARTVLEALQQCRPSPEL
TLSQKIKAKLQNPDLLELCHLVPKEVVQLGEAWGGQDGRRPLP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC043297
ORF Size 759 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC043297, AAH43297
RefSeq Size 1857 bp
RefSeq ORF 761 bp
Locus ID 72774
MW 28.5 kDa
Gene Summary Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as DNA glycosylase that recognizes and removes damaged bases. Has a preference for oxidized pyrimidines, such as thymine glycol, formamidopyrimidine (Fapy) and 5-hydroxyuracil. Has marginal activity towards 8-oxoguanine. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Has DNA glycosylase/lyase activity towards mismatched uracil and thymine, in particular in U:C and T:C mismatches. Specifically binds 5-hydroxymethylcytosine (5hmC), suggesting that it acts as a specific reader of 5hmC.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...