NEK11 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NEK11 antibody: synthetic peptide directed towards the middle region of human NEK11. Synthetic peptide located within the following region: KEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	74 kDa
Gene Name	NIMA related kinase 11
Database Link	NP_079076 Entrez Gene 79858 Human UniProt ID Q8NG66
Background	This gene encodes a member of the never in mitosis gene A family of kinases. The encoded protein localizes to the nucleoli, and may function with NEK2A in the S-phase checkpoint. The encoded protein appears to play roles in DNA replication and response to genotoxic stress. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009]
Synonyms	FLJ23495
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rat: 79%; Bovine: 77%
Reference Data
Protein Families	Druggable Genome, Protein Kinase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.