NEK11 (NM_024800) Human Recombinant Protein
CAT#: TP321953
Recombinant protein of human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1, 20 µg
View other "NEK11" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221953 representing NM_024800
Red=Cloning site Green=Tags(s) MLKFQEAAKCVSGSTAISTYPKTLIARRYVLQQKLGSGSFGTVYLVSDKKAKRGEELKVLKEISVGELNP NETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFI QLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYD TKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIE ILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKL QAADEKARKLKKIVEEKYEENSKRMQELRSRNFQQLSVDVLHEKTHLKGMEEKEEQPEGRLSCSPQDEDE ERWQGREEESDEPTLENLPESQPIPSMDLHELESIVEDATSDLGYHEIPEDPLVAEEYYADAFDSYCVES DEEEEEIALERPEKEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMSPGPPIFN SVMARTKMKRMRESAMQKLGTEVFEEVYNYLKRARHQNASEAEIRECLEKVVPQASDCFEVDQLLYFEEQ LLITMGKEPTLQNHL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 74 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079076 |
Locus ID | 79858 |
UniProt ID | Q8NG66, B4DM56 |
Refseq Size | 2939 |
Cytogenetics | 3q22.1 |
Refseq ORF | 1935 |
Summary | This gene encodes a member of the never in mitosis gene A family of kinases. The encoded protein localizes to the nucleoli, and may function with NEK2A in the S-phase checkpoint. The encoded protein appears to play roles in DNA replication and response to genotoxic stress. Alternatively spliced transcript variants have been described.[provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407844 | NEK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC411057 | NEK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC431511 | NEK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407844 | Transient overexpression lysate of NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 2 |
CNY 4,840.00 |
|
LY411057 | Transient overexpression lysate of NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1 |
CNY 4,840.00 |
|
LY431511 | Transient overexpression lysate of NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 3 |
CNY 3,080.00 |
|
PH321953 | NEK11 MS Standard C13 and N15-labeled recombinant protein (NP_079076) |
CNY 19,520.00 |