LEFTY2 Rabbit Polyclonal Antibody

CAT#: TA346347

Rabbit Polyclonal Anti-LEFTY2 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (2)
Transient overexpression lysate of left-right determination factor 2 (LEFTY2)
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-LEFTY2 antibody is: synthetic peptide directed towards the N-terminal region of Human LEFTY2. Synthetic peptide located within the following region: AGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 40 kDa
Gene Name left-right determination factor 2
Background LEFTY2 is a member of the TGF-beta family of proteins. The protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in its gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of its gene in the endometrium.
Synonyms EBAF; LEFTA; LEFTYA; TGFB4
Note Immunogen Sequence Homology: Human: 100%; Dog: 83%; Rat: 83%; Pig: 77%
Reference Data
Protein Families Druggable Genome, Secreted Protein
Protein Pathways TGF-beta signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...