RASSF7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RASSF7 antibody: synthetic peptide directed towards the middle region of human RASSF7. Synthetic peptide located within the following region: DISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	Ras association domain family member 7
Database Link	NP_003466 Entrez Gene 8045 Human UniProt ID Q02833
Background	The function remains unknown.
Synonyms	C11orf13; HRAS1; HRC1
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 86%; Pig: 79%; Bovine: 79%; Horse: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.