RASSF7 (NM_003475) Human Recombinant Protein
CAT#: TP312844
Recombinant protein of human Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 (RASSF7), transcript variant 1, 20 µg
View other "RASSF7" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212844 representing NM_003475
Red=Cloning site Green=Tags(s) MLLGLAAMELKVWVDGIQRVVCGVSEQTTCQEVVIALAQAIGQTGRFVLVQRLREKERQLLPQECPVGAQ ATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPERCLIRASLPVKPRAALGCEPRKTLTPEPAPSLSRPG PAAPVTPTPGCCTDLRGLELRVQRNAEELGHEAFWEQELRREQAREREGQARLQALSAATAEHAARLQAL DAQARALEAELQLAAEAPGPPSPMASATERLHQDLAVQERQSAEVQGSLALVSRALEAAERALQAQAQEL EELNRELRQCNLQQFIQQTGAALPPPPRPDRGPPGTQGPLPPAREESLLGAPSESHAGAQPRPRGGPHDA ELLEVAAAPAPEWCPLAAQPQAL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003466 |
Locus ID | 8045 |
UniProt ID | Q02833 |
Refseq Size | 1539 |
Cytogenetics | 11p15.5 |
Refseq ORF | 1119 |
Synonyms | C11orf13; CFAP88; FAP88; HRAS1; HRC1 |
Summary | Negatively regulates stress-induced JNK activation and apoptosis by promoting MAP2K7 phosphorylation and inhibiting its ability to activate JNK. Following prolonged stress, anti-apoptotic effect stops because of degradation of RASSF7 protein via the ubiquitin-proteasome pathway. Required for the activation of AURKB and chromosomal congression during mitosis where it stimulates microtubule polymerization.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418659 | RASSF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428453 | RASSF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418659 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 (RASSF7), transcript variant 1 |
CNY 3,080.00 |
|
LY428453 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 (RASSF7), transcript variant 2 |
CNY 3,080.00 |
|
PH312844 | RASSF7 MS Standard C13 and N15-labeled recombinant protein (NP_003466) |
CNY 14,250.00 |