UCHL3 Rabbit Polyclonal Antibody

CAT#: TA344239

Rabbit Polyclonal Anti-UCHL3 Antibody - N-terminal region



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human, Zebrafish
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-UCHL3 antibody: synthetic peptide directed towards the N terminal of human UCHL3. Synthetic peptide located within the following region: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 25 kDa
Gene Name ubiquitin C-terminal hydrolase L3
Background UCHL3 is an ubiquitin-protein hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8.
Synonyms UCH-L3
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%; Goat: 82%
Reference Data
Protein Families Druggable Genome, Protease
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...