TRIM32 Rabbit Polyclonal Antibody

CAT#: TA343687

Rabbit Polyclonal Anti-TRIM32 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of tripartite motif-containing 32 (TRIM32), transcript variant 1
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human tripartite motif-containing 32 (TRIM32), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human tripartite motif-containing 32 (TRIM32), transcript variant 1, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the N terminal of human TRIM32. Synthetic peptide located within the following region: MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 72 kDa
Gene Name tripartite motif containing 32
Background TRIM32 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM32 localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.
Synonyms BBS11; HT2A; LGMD2H; TATIP
Note Immunogen Sequence Homology: Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data
Protein Families Transcription Factors
Protein Pathways Ubiquitin mediated proteolysis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...