CHIC2 Rabbit Polyclonal Antibody

CAT#: TA341897

Rabbit Polyclonal Anti-CHIC2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of cysteine-rich hydrophobic domain 2 (CHIC2)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human cysteine-rich hydrophobic domain 2 (CHIC2), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human cysteine-rich hydrophobic domain 2 (CHIC2), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CHIC2 antibody: synthetic peptide directed towards the N terminal of human CHIC2. Synthetic peptide located within the following region: MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 19 kDa
Gene Name cysteine rich hydrophobic domain 2
Background This gene encodes a member ofThe CHIC family of proteins.The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures andThe plasma membrane.This gene is associated with some cases of acute myeloid leukemia. [provided by RefSeq, Jul 2008]
Synonyms BTL
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 92%; Yeast: 80%
Reference Data
Protein Families Druggable Genome, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...