CHIC2 (NM_012110) Human Recombinant Protein
CAT#: TP304420
Recombinant protein of human cysteine-rich hydrophobic domain 2 (CHIC2), 20 µg
View other "CHIC2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204420 protein sequence
Red=Cloning site Green=Tags(s) MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINR VNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRK CETNNMMEYVILIEFLPKTPIFRPD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036242 |
Locus ID | 26511 |
UniProt ID | Q9UKJ5 |
Refseq Size | 1178 |
Cytogenetics | 4q12 |
Refseq ORF | 495 |
Synonyms | BTL |
Summary | This gene encodes a member of the CHIC family of proteins. The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. This gene is associated with some cases of acute myeloid leukemia. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415979 | CHIC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415979 | Transient overexpression lysate of cysteine-rich hydrophobic domain 2 (CHIC2) |
CNY 3,080.00 |
|
PH304420 | CHIC2 MS Standard C13 and N15-labeled recombinant protein (NP_036242) |
CNY 19,520.00 |