VAX1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Vax1 antibody: synthetic peptide directed towards the middle region of mouse Vax1. Synthetic peptide located within the following region: RERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSETAATCS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	ventral anterior homeobox 1
Database Link	NP_001106175 Entrez Gene 22326 Mouse UniProt ID Q5SQQ9
Background	Vax1 is required for axon guidance and major tract formation inThe developing forebrain. It may contribute toThe differentiation ofThe neuroretina, pigmented epithelium and optic stalk.
Synonyms	MCOPS11
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.