VAX1 (NM_199131) Human Recombinant Protein
CAT#: TP310985
Recombinant protein of human ventral anterior homeobox 1 (VAX1), transcript variant 2, 20 µg
View other "VAX1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210985 protein sequence
Red=Cloning site Green=Tags(s) MFGKPDKMDVRCHSDAEAARVSKNAHKESRESKGAEGNLPAAFLKEPQGAFSASGAAEDCNKSKSNSAAD PDYCRRILVRDAKGSIREIILPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLS ETQANSEENNERFKRGIKKQKKKRKKEPANDESRRGDSGGRGWQPL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_954582 |
Locus ID | 11023 |
UniProt ID | Q5SQQ9 |
Refseq Size | 4494 |
Cytogenetics | 10q25.3 |
Refseq ORF | 558 |
Synonyms | MCOPS11 |
Summary | This gene encodes a homeo-domain containing protein from a class of homeobox transcription factors which are conserved in vertebrates. Genes of this family are involved in the regulation of body development and morphogenesis. The most conserved genes, called HOX genes are found in special gene clusters. This gene belongs to the VAX subfamily and lies in the vicinity of the EMX homeobox gene family. Another member of VAX family is located on chromosome 2. The encoded protein may play an important role in the development of anterior ventral forebrain and visual system. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404744 | VAX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426368 | VAX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404744 | Transient overexpression lysate of ventral anterior homeobox 1 (VAX1), transcript variant 2 |
CNY 3,080.00 |
|
LY426368 | Transient overexpression lysate of ventral anterior homeobox 1 (VAX1), transcript variant 1 |
CNY 3,080.00 |
|
PH310985 | VAX1 MS Standard C13 and N15-labeled recombinant protein (NP_954582) |
CNY 19,520.00 |