CRY2 Rabbit Polyclonal Antibody
CNY 5,200.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
CNY 9,998.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CRY2 antibody: synthetic peptide directed towards the N terminal of human CRY2. Synthetic peptide located within the following region: IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 67 kDa |
Gene Name | cryptochrome circadian clock 2 |
Database Link | |
Background | CRY2 is a blue light-dependent regulator of the circadian feedback loop.CRY2 inhibits CLOCK NPAS2-ARNTL E box-mediated transcription. CRY2 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity.CRY2 has no photolyase activity. CRY2 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus.CRY2 may inhibit CLOCK NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL. |
Synonyms | HCRY2; PHLL2 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Circadian rhythm - mammal |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |