CRY2 Rabbit Polyclonal Antibody

CAT#: TA340193

Rabbit Polyclonal Anti-CRY2 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1, 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Transient overexpression lysate of cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1
    • 100 ug

CN¥ 3,080.00


Recombinant protein of human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1, 100 µg
    • 100 ug

CN¥ 9,998.00


Transient overexpression lysate of cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1
    • 100 ug

CN¥ 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CRY2 antibody: synthetic peptide directed towards the N terminal of human CRY2. Synthetic peptide located within the following region: IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 67 kDa
Gene Name cryptochrome circadian clock 2
Background CRY2 is a blue light-dependent regulator of the circadian feedback loop.CRY2 inhibits CLOCK NPAS2-ARNTL E box-mediated transcription. CRY2 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity.CRY2 has no photolyase activity. CRY2 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus.CRY2 may inhibit CLOCK NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.
Synonyms HCRY2; PHLL2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data
Protein Families Druggable Genome
Protein Pathways Circadian rhythm - mammal
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...