CRY2 (NM_021117) Human Recombinant Protein
CAT#: TP307337
Recombinant protein of human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1, 20 µg
View other "CRY2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207337 protein sequence
Red=Cloning site Green=Tags(s) MAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINR WRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAG VEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYG VPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLS CRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWA EGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLS CSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIV NHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPK RKLEAAEEPPGEELSKRARVAELPTPELPSKDA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 66.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_066940 |
Locus ID | 1408 |
UniProt ID | Q49AN0, A0A0D2X7Z3, A2I2P1 |
Refseq Size | 4204 |
Cytogenetics | 11p11.2 |
Refseq ORF | 1779 |
Synonyms | HCRY2; PHLL2 |
Summary | This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2014] |
Protein Families | Druggable Genome |
Protein Pathways | Circadian rhythm - mammal |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412078 | CRY2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432326 | CRY2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412078 | Transient overexpression lysate of cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1 |
CNY 3,080.00 |
|
LY432326 | Transient overexpression lysate of cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1 |
CNY 3,080.00 |
|
PH307337 | CRY2 MS Standard C13 and N15-labeled recombinant protein (NP_066940) |
CNY 19,520.00 |