FAM54A (MTFR2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FAM54A antibody: synthetic peptide directed towards the middle region of human FAM54A. Synthetic peptide located within the following region: NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	mitochondrial fission regulator 2
Database Link	NP_001092756 Entrez Gene 113115 Human UniProt ID Q6P444
Background	FAM54A belongs to the MTFR1/FAM54 family. The function of the FAM54A protein is not known.
Synonyms	DUFD1; FAM54A
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 85%; Rabbit: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.