HES4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HES4 antibody: synthetic peptide directed towards the middle region of human HES4. Synthetic peptide located within the following region: GHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	hes family bHLH transcription factor 4
Database Link	NP_066993 Entrez Gene 57801 Human UniProt ID Q9HCC6
Background	Transcriptional repressor. Binds DNA on N-box motifs: 5'-CACNAG-3'.
Synonyms	bHLHb42
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 91%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.