HES4 (NM_001142467) Human Recombinant Protein
CAT#: TP327268
Recombinant protein of human hairy and enhancer of split 4 (Drosophila) (HES4), transcript variant 1, 20 µg
View other "HES4" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227268 representing NM_001142467
Red=Cloning site Green=Tags(s) MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKVGSRPGVRGATGGREGRGTQPVPDPQSSKPVMEK RRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGF HECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGG PFPLLAPPLLPGLTRALPAAPRAGPQGPGGPWRPWLR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001135939 |
Locus ID | 57801 |
UniProt ID | Q9HCC6 |
Cytogenetics | 1p36.33 |
Refseq ORF | 741 |
Synonyms | bHLHb42 |
Summary | Transcriptional repressor. Binds DNA on N-box motifs: 5'-CACNAG-3' (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412047 | HES4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428113 | HES4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412047 | Transient overexpression lysate of hairy and enhancer of split 4 (Drosophila) (HES4), transcript variant 2 |
CNY 3,080.00 |
|
LY428113 | Transient overexpression lysate of hairy and enhancer of split 4 (Drosophila) (HES4), transcript variant 1 |
CNY 3,080.00 |
|
PH327268 | HES4 MS Standard C13 and N15-labeled recombinant protein (NP_001135939) |
CNY 14,250.00 |