ZNF213 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF213 antibody: synthetic peptide directed towards the N terminal of human ZNF213. Synthetic peptide located within the following region: ATGPPPTVGARRRPSVPQEQHSHSAQPPALLKEGRPGETTDTCFVSGVHG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	zinc finger protein 213
Database Link	NP_004211 Entrez Gene 7760 Human UniProt ID O14771
Background	C2H2 zinc finger proteins, such as ZNF213, have bipartite structures in which one domain binds DNA or RNA and the other modulates target gene expression. [supplied by OMIM, Apr 2004]. Transcript Variant: This variant (2) uses an alternate donor splice site at the first exon, hence has a different 5' UTR compared to variant 1. Transcript variants 1 and 2 encode the same protein. ##Evidence-Data-START## Transcript exon combination :: AK289834.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025083, ERS025087 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Synonyms	CR53; ZKSCAN21; ZSCAN53
Note	Immunogen Sequence Homology: Human: 100%; Horse: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.