ZNF213 (NM_004220) Human Recombinant Protein
CAT#: TP303547
Recombinant protein of human zinc finger protein 213 (ZNF213), transcript variant 1, 20 µg
View other "ZNF213" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203547 protein sequence
Red=Cloning site Green=Tags(s) MAAPLEAQDQAPGEGEGLLIVKVEDSSWEQESAQHEDGRDSEACRQRFRQFCYGDVHGPHEAFSQLWELC CRWLRPELRTKEQILELLVLEQFLTVLPGEIQGWVREQHPGSGEEAVALVEDLQKQPVKAWRQDVPSEEA EPEAAGRGSQATGPPPTVGARRRPSVPQEQHSHSAQPPALLKEGRPGETTDTCFVSGVHGPVALGDIPFY FSREEWGTLDPAQRDLFWDIKRENSRNTTLGFGLKGQSEKSLLQEMVPVVPGQTGSDVTVSWSPEEAEAW ESENRPRAALGPVVGARRGRPPTRRRQFRDLAAEKPHSCGQCGKRFRWGSDLARHQRTHTGEKPHKCPEC DKSFRSSSDLVRHQGVHTGEKPFSCSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHR RVHTGERPFGCGECDKSFKQRAHLIAHQSLHAKMAQPVG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004211 |
Locus ID | 7760 |
UniProt ID | O14771, A0A0S2Z4L6 |
Refseq Size | 3301 |
Cytogenetics | 16p13.3 |
Refseq ORF | 1377 |
Synonyms | CR53; ZKSCAN21; ZSCAN53 |
Summary | C2H2 zinc finger proteins, such as ZNF213, have bipartite structures in which one domain binds DNA or RNA and the other modulates target gene expression.[supplied by OMIM, Apr 2004] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418147 | ZNF213 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427465 | ZNF213 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418147 | Transient overexpression lysate of zinc finger protein 213 (ZNF213), transcript variant 1 |
CNY 3,080.00 |
|
LY427465 | Transient overexpression lysate of zinc finger protein 213 (ZNF213), transcript variant 2 |
CNY 3,080.00 |
|
PH303547 | ZNF213 MS Standard C13 and N15-labeled recombinant protein (NP_004211) |
CNY 19,520.00 |