LSM12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LSM12 antibody: synthetic peptide directed towards the middle region of human LSM12. Synthetic peptide located within the following region: PPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAAL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	LSM12 homolog
Database Link	NP_689557 Entrez Gene 124801 Human UniProt ID Q3MHD2
Background	LSM12 belongs to the LSM12 family. The exact function of LSM12 is not known.
Synonyms	PNAS-135
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.