LSM12 (NM_152344) Human Recombinant Protein
CAT#: TP308457
Recombinant protein of human LSM12 homolog (S. cerevisiae) (LSM12), 20 µg
View other "LSM12" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208457 protein sequence
Red=Cloning site Green=Tags(s) MAAPPGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHADILLINLQYVSEVEIIN DRTETPRPLASLNVSKLASKARTEKEEKLSQAYAISAGVSLEGQQLFQTIHKTIKDCKWQEKNIVVMEEV VITPPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAALSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689557 |
Locus ID | 124801 |
UniProt ID | Q3MHD2 |
Refseq Size | 2507 |
Cytogenetics | 17q21.31 |
Refseq ORF | 585 |
Synonyms | PNAS-135 |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Lsm12 is an NAADP receptor and a two-pore channel regulatory protein required for calcium mobilization from acidic organelles
,null,
Nature Communications
,PubMed ID 34362892
[LSM12]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407594 | LSM12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407594 | Transient overexpression lysate of LSM12 homolog (S. cerevisiae) (LSM12) |
CNY 3,080.00 |
|
PH308457 | LSM12 MS Standard C13 and N15-labeled recombinant protein (NP_689557) |
CNY 19,520.00 |