DECTIN 2 (CLEC6A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CLEC6A Antibody: synthetic peptide directed towards the N terminal of human CLEC6A. Synthetic peptide located within the following region: FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	C-type lectin domain family 6 member A
Database Link	NP_001007034 Entrez Gene 93978 Human UniProt ID Q6EIG7
Background	CLEC6A may be involved in regulating immune reactivity.
Synonyms	CLEC4N; CLECSF10
Note	Immunogen Sequence Homology: Human: 100%; Rat: 90%; Mouse: 90%; Bovine: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.