BAP29 (BCAP29) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-BCAP29 Antibody: synthetic peptide directed towards the middle region of human BCAP29. Synthetic peptide located within the following region: GVMEPQQRNADSHQKLEEAKNRFFPRASSSRSMALQIPIKLILDFLASRT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	B-cell receptor-associated protein 29
Database Link	NP_001008406 Entrez Gene 55973 Human UniProt ID Q9UHQ4
Background	BCAP29 may play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. BCAP29 may be involved in CASP8-mediated apoptosis.
Synonyms	B-cell receptor-associated protein 29; B-cell receptor-associated protein BAP29; BAP29; DKFZp686M2086
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.