BAP29 (BCAP29) (NM_018844) Human Recombinant Protein
CAT#: TP303331
Recombinant protein of human B-cell receptor-associated protein 29 (BCAP29), transcript variant 2, 20 µg
View other "BAP29" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203331 protein sequence
Red=Cloning site Green=Tags(s) MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREV RKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQ AENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKM QSERLSKEYDQLLKEHSELQDRLERGNKKRL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061332 |
Locus ID | 55973 |
UniProt ID | Q9UHQ4, E9PAJ1 |
Refseq Size | 6034 |
Cytogenetics | 7q22.3 |
Refseq ORF | 723 |
Synonyms | BAP29 |
Summary | May play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. May be involved in CASP8-mediated apoptosis (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412884 | BCAP29 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423427 | BCAP29 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423428 | BCAP29 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425235 | BCAP29 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412884 | Transient overexpression lysate of B-cell receptor-associated protein 29 (BCAP29), transcript variant 2 |
CNY 3,080.00 |
|
LY423427 | Transient overexpression lysate of B-cell receptor-associated protein 29 (BCAP29), transcript variant 1 |
CNY 3,080.00 |
|
LY423428 | Transient overexpression lysate of B-cell receptor-associated protein 29 (BCAP29), transcript variant 3 |
CNY 3,080.00 |
|
PH303331 | BCAP29 MS Standard C13 and N15-labeled recombinant protein (NP_061332) |
CNY 19,520.00 |