PODXL Rabbit Polyclonal Antibody
CAT#: TA336066
Rabbit Polyclonal Anti-PODXL Antibody
Need it in bulk or conjugated?
Get a free quote
CN¥ 5,250.00
CN¥ 2,900.00
CN¥ 6,650.00
CN¥ 3,080.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-PODXL Antibody: synthetic peptide directed towards the middle region of human PODXL. Synthetic peptide located within the following region: PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 56 kDa |
Gene Name | podocalyxin like |
Database Link | |
Background | PODXL is a member of the sialomucin protein family. PODXL was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin.This gene encodes a member of the sialomucin protein family. The encoded protein was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the encoded protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin. |
Synonyms | Gp200; PC; PCLP; PCLP-1 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |