PODXL (NM_005397) Human Recombinant Protein
CAT#: TP310816
Purified recombinant protein of Homo sapiens podocalyxin-like (PODXL), transcript variant 2, 20 µg
View other "PODXL" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210816 protein sequence
Red=Cloning site Green=Tags(s) MRCALALSALLLLLSTPPLLPSSPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSK ANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTAT AKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLM KISSSSSTVAIPGYTFTSPGMTTTLPSSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPE TMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICR AVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPE EAEDRFSMPLIITIVCMASFLLLVAALYGCCHQRLSQRKDQQRLTEELQTVENGYHDNPTLEVMETSSEM QEKKVVSLNGELGDSWIVPLDNLTKDDLDEEEDTHL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005388 |
Locus ID | 5420 |
UniProt ID | O00592 |
Refseq Size | 5911 |
Cytogenetics | 7q32.3 |
Refseq ORF | 1578 |
Synonyms | gp135; Gp200; PC; PCLP; PCLP-1; PDX; PODXL1 |
Summary | This gene encodes a member of the sialomucin protein family. The encoded protein was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the encoded protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401657 | PODXL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401657 | Transient overexpression lysate of podocalyxin-like (PODXL), transcript variant 2 |
CNY 3,080.00 |
|
PH310816 | PODXL MS Standard C13 and N15-labeled recombinant protein (NP_005388) |
CNY 14,250.00 |
|
TP700181 | Purified recombinant protein of Homo sapiens podocalyxin-like (PODXL), transcript variant 2, residues Ser23-Pro461, expressed in HEK293 cells. |
CNY 6,650.00 |
|
TP700182 | Purified recombinant protein of Homo sapiens podocalyxin-like (PODXL), transcript variant 2, residues Gln32-Pro461, expressed in HEK293 cells. |
CNY 6,650.00 |
|
TP762498 | Purified recombinant protein of Human podocalyxin-like (PODXL), transcript variant 1, 273Ser-459Ser, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 2,150.00 |