PLD3 Rabbit Polyclonal Antibody

CAT#: TA336040

Rabbit Polyclonal Anti-PLD3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human phospholipase D family, member 3 (PLD3), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00


Transient overexpression lysate of phospholipase D family, member 3 (PLD3), transcript variant 2
    • 100 ug

CNY 3,080.00


Recombinant protein of human phospholipase D family, member 3 (PLD3), transcript variant 1, 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of phospholipase D family, member 3 (PLD3), transcript variant 1
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-PLD3 Antibody: synthetic peptide directed towards the N terminal of human PLD3. Synthetic peptide located within the following region: WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 55 kDa
Gene Name phospholipase D family member 3
Background PLD3 is a ingle-pass type II membrane protein. It belongs to the phospholipase D family. PLD3 contains 2 PLD phosphodiesterase domains. The exact function of PLD3 remains unknown.
Synonyms AD19; HU-K4; HUK4
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...