PLD3 (NM_001031696) Human Recombinant Protein
CAT#: TP306783
Recombinant protein of human phospholipase D family, member 3 (PLD3), transcript variant 1, 20 µg
View other "PLD3" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206783 protein sequence
Red=Cloning site Green=Tags(s) MKPKLMYQELKVPAEEPANELPMNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGP NQRPAPCYDPCEAVLVESIPEGLDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPS AQQGEEVLRQLQTLAPKGVNVRIAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTHGVLHTKFWVVDQT HFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRFYDTRYNQETPME ICLNGTPALAYLASAPPPLCPSGRTPDLKALLNVVDNARSFIYVAVMNYLPTLEFSHPHRFWPAIDDGLR RATYERGVKVRLLISCWGHSEPSMRAFLLSLAALRDNHTHSDIQVKLFVVPADEAQARIPYARVNHNKYM VTERATYIGTSNWSGNYFTETAGTSLLVTQNGRGGLRSQLEAIFLRDWDSPYSHDLDTSADSVGNACRLL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001026866 |
Locus ID | 23646 |
UniProt ID | Q8IV08, A0A024R0Q4 |
Refseq Size | 2207 |
Cytogenetics | 19q13.2 |
Refseq ORF | 1470 |
Synonyms | AD19; HU-K4; HUK4; SCA46 |
Summary | This gene encodes a member of the phospholipase D (PLD) family of enzymes that catalyze the hydrolysis of membrane phospholipids. The encoded protein is a single-pass type II membrane protein and contains two PLD phosphodiesterase domains. This protein influences processing of amyloid-beta precursor protein. Mutations in this gene are associated with Alzheimer disease risk. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Apr 2014] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400411 | PLD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415872 | PLD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429360 | PLD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400411 | Transient overexpression lysate of phospholipase D family, member 3 (PLD3), transcript variant 1 |
CNY 3,080.00 |
|
LY415872 | Transient overexpression lysate of phospholipase D family, member 3 (PLD3), transcript variant 2 |
CNY 3,080.00 |
|
LY429360 | Transient overexpression lysate of phospholipase D family, member 3 (PLD3), transcript variant 2 |
CNY 3,080.00 |
|
PH306783 | PLD3 MS Standard C13 and N15-labeled recombinant protein (NP_001026866) |
CNY 19,520.00 |