FAIM1 (FAIM) Rabbit Polyclonal Antibody
CN¥ 4,628.00
CN¥ 300.00
CN¥ 1,430.00
CN¥ 2,900.00
CN¥ 6,650.00
CN¥ 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-FAIM Antibody: synthetic peptide directed towards the N terminal of human FAIM. Synthetic peptide located within the following region: MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 24 kDa |
Gene Name | Fas apoptotic inhibitory molecule |
Database Link | |
Background | FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells. |
Synonyms | FAIM1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |