CCDC103 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CCDC103 antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC103. Synthetic peptide located within the following region: RAAVLGILCSLASTGRFTLNLSLLSRAERESCKGLFQKLQAMGNPRSVKE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	coiled-coil domain containing 103
Database Link	NP_998772 Entrez Gene 388389 Human UniProt ID Q8IW40
Background	This gene encodes a protein that contains a coiled-coil domain.
Synonyms	CILD17; PR46b; SMH
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Bovine: 86%; Rabbit: 83%; Dog: 79%; Rat: 79%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.