TULP3 Rabbit Polyclonal Antibody

CAT#: TA334012

Rabbit Polyclonal Anti-TULP3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human tubby like protein 3 (TULP3), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of tubby like protein 3 (TULP3), transcript variant 2
    • 100 ug

CNY 3,080.00


Recombinant protein of human tubby like protein 3 (TULP3), 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of tubby like protein 3 (TULP3), transcript variant 1
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-TULP3 Antibody: synthetic peptide directed towards the middle region of human TULP3. Synthetic peptide located within the following region: GLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYLISIDPVDLSREGESY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 50 kDa
Gene Name tubby like protein 3
Background TULP3 is a member of the tubby-like protein (TULP) family. Members of this family have been identified in plants, vertebrates, and invertebrates, and they share a conserved C-terminal region of approximately 200 amino acid residues. The human and mouse TULP3 proteins share 69% amino acid sequence identity, with higher identity at the N and C termini than in the central region.This gene encodes a member of the tubby-like protein (TULP) family. Members of this family have been identified in plants, vertebrates, and invertebrates, and they share a conserved C-terminal region of approximately 200 amino acid residues. The human and mouse TULP3 proteins share 69% amino acid sequence identity, with higher identity at the N and C termini than in the central region.
Synonyms TUBL3
Note Immunogen sequence homology: Human: 100%; Mouse: 85%; Rabbit: 85%; Dog: 77%; Horse: 77%; Bovine: 77%
Reference Data
Protein Families Druggable Genome, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...