TULP3 (NM_003324) Human Recombinant Protein
CAT#: TP307595
Recombinant protein of human tubby like protein 3 (TULP3), 20 µg
View other "TULP3" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207595 protein sequence
Red=Cloning site Green=Tags(s) MEASRCRLSPSGDSVFHEEMMKMRQAKLDYQRLLLEKRQRKKRLEPFMVQPNPEARLRRAKPRASDEQTP LVNCHTPHSNVILHGIDGPAAVLKPDEVHAPSVSSSVVEEDAENTVDTASKPGLQERLQKHDISESVNFD EETDGISQSACLERPNSASSQNSTDTGTSGSATAAQPADNLLGDIDYLEDFVYSPAPQGVTVRCRIIRDK RGMDRGLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYLISIDPVDLSREGESYVGKLRSNLMGTKFTV YDRGICPMKGRGLVGAAHTRQELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRW QNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQIVHKNDPDYIVMQFGRVADDVFTLDYNY PLCAVQAFGIGLSSFDSKLACE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 49.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003315 |
Locus ID | 7289 |
UniProt ID | O75386, B7Z1E7 |
Refseq Size | 3106 |
Cytogenetics | 12p13.33 |
Refseq ORF | 1326 |
Synonyms | TUBL3 |
Summary | This gene encodes a member of the tubby gene family of bipartite transcription factors. Members of this family have been identified in plants, vertebrates, and invertebrates, and they share a conserved N-terminal transcription activation region and a conserved C-terminal DNA and phosphatidylinositol-phosphate binding region. The encoded protein binds to phosphoinositides in the plasma membrane via its C-terminal region and probably functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis, for instance, induced by G-protein-coupled-receptor signaling. It plays an important role in neuronal development and function. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, May 2009] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418767 | TULP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431443 | TULP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418767 | Transient overexpression lysate of tubby like protein 3 (TULP3), transcript variant 1 |
CNY 3,080.00 |
|
LY431443 | Transient overexpression lysate of tubby like protein 3 (TULP3), transcript variant 2 |
CNY 3,080.00 |
|
PH307595 | TULP3 MS Standard C13 and N15-labeled recombinant protein (NP_003315) |
CNY 19,520.00 |