EAAT3 (SLC1A1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC1A1 Antibody: synthetic peptide directed towards the N terminal of human SLC1A1. Synthetic peptide located within the following region: LDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	solute carrier family 1 member 1
Database Link	NP_004161 Entrez Gene 6505 Human UniProt ID P43005
Background	This gene encodes a member of the high-affinity glutamate transporters that play an essential role in transporting glutamate across plasma membranes. In brain, these transporters are crucial in terminating the postsynaptic action of the neurotransmitter glutamate, and in maintaining extracellular glutamate concentrations below neurotoxic levels. This transporter also transports aspartate, and mutations in this gene are thought to cause dicarboxylicamino aciduria, also known as glutamate-aspartate transport defect. [provided by RefSeq, Mar 2010]
Synonyms	DCBXA; EAAC1; EAAT3; SCZD18
Note	Immunogen sequence homology: Human: 100%; Rat: 92%; Mouse: 85%; Dog: 77%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.