WDSUB1 Rabbit Polyclonal Antibody

CAT#: TA330512

Rabbit Polyclonal Anti-WDSUB1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of WD repeat, sterile alpha motif and U-box domain containing 1 (WDSUB1), transcript variant 3
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human WD repeat, sterile alpha motif and U-box domain containing 1 (WDSUB1), transcript variant 3, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human WD repeat, sterile alpha motif and U-box domain containing 1 (WDSUB1), transcript variant 3, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-WDSUB1 antibody: synthetic peptide directed towards the middle region of human WDSUB1. Synthetic peptide located within the following region: KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 53 kDa
Gene Name WD repeat, sterile alpha motif and U-box domain containing 1
Background WDSUB1 contains 1 SAM (sterile alpha motif) domain, 1 U-box domain and 7 WD repeats. The function of WDSUB1 remains unknown.
Synonyms UBOX6; WDSAM1
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 92%; Goat: 83%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...