WDSUB1 (NM_152528) Human Recombinant Protein
CAT#: TP312468
Recombinant protein of human WD repeat, sterile alpha motif and U-box domain containing 1 (WDSUB1), transcript variant 3, 20 µg
View other "WDSUB1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212468 representing NM_152528
Red=Cloning site Green=Tags(s) MVKLIHTLADHGDDVNCCAFSFSLLATCSLDKTIRLYSLRDFTELPHSPLKFHTYAVHCCCFSPSGHILA SCSTDGTTVLWNTENGQMLAVMEQPSGSPVRVCQFSPDSTCLASGAADGTVVLWNAQSYKLYRCGSVKDG SLAACAFSPNGSFFVTGSSCGDLTVWDDKMRCLHSEKAHDLGITCCDFSSQPVSDGEQGLQFFRLASCGQ DCQVKIWIVSFTHILGFELKYKSTLSGHCAPVLACAFSHDGQMLVSGSVDKSVIVYDTNTENILHTLTQH TRYVTTCAFAPNTLLLATGSMDKTVNIWQFDLETLCQARRTEHQLKQFTEDWSEEDVSTWLCAQDLKDLV GIFKMNNIDGKELLNLTKESLADDLKIESLGLRSKVLRKIEELRTKVKSLSSGIPDEFICPITRELMKDP VIASDGYSYEKEAMENWISKKKRTSPMTNLVLPSAVLTPNRTLKMAINRWLETHQK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689741 |
Locus ID | 151525 |
UniProt ID | Q8N9V3 |
Refseq Size | 1811 |
Cytogenetics | 2q24.2 |
Refseq ORF | 1428 |
Synonyms | UBOX6; WDSAM1 |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407482 | WDSUB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC426926 | WDSUB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426927 | WDSUB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY407482 | Transient overexpression lysate of WD repeat, sterile alpha motif and U-box domain containing 1 (WDSUB1), transcript variant 3 |
CN¥ 4,840.00 |
|
LY426926 | Transient overexpression lysate of WD repeat, sterile alpha motif and U-box domain containing 1 (WDSUB1), transcript variant 2 |
CN¥ 3,080.00 |
|
LY426927 | Transient overexpression lysate of WD repeat, sterile alpha motif and U-box domain containing 1 (WDSUB1), transcript variant 1 |
CN¥ 3,080.00 |
|
PH312468 | WDSUB1 MS Standard C13 and N15-labeled recombinant protein (NP_689741) |
CN¥ 19,520.00 |